PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100113030061
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family HD-ZIP
Protein Properties Length: 273aa    MW: 30991.8 Da    PI: 7.7559
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100113030061genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.74.6e-19122176256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Ote100113030061|100113030061 122 RKKLRLSKEQAAVLEETFKEHSTLNPKQKMGLAKQLNLRPRQVEVWFQNRRARTK 176
                                   788899***********************************************98 PP

2HD-ZIP_I/II127.84.5e-41122211191
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlskeq+++LEe+F+e+++L+p++K+ la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+L+r++++l+een+rL+
  Ote100113030061|100113030061 122 RKKLRLSKEQAAVLEETFKEHSTLNPKQKMGLAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRRCCENLTEENRRLQ 202
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreel 91 
                                   kev+eLr +l
  Ote100113030061|100113030061 203 KEVSELR-AL 211
                                   ******9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.9E-231109IPR006712HD-ZIP protein, N-terminal
PROSITE profilePS5007117.184118178IPR001356Homeobox domain
SMARTSM003892.9E-14120182IPR001356Homeobox domain
SuperFamilySSF466891.58E-18121187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-18122176IPR009057Homeodomain-like
CDDcd000861.95E-14122179No hitNo description
PfamPF000461.4E-16122176IPR001356Homeobox domain
PROSITE patternPS000270153176IPR017970Homeobox, conserved site
PfamPF021836.2E-11178212IPR003106Leucine zipper, homeobox-associated
SMARTSM003403.4E-26178221IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
EKEDLLGLSL SLKCPENHDN DPPPPPSRPT PSLPFSLNLL RSPLPFLQHK SSAAESFQQF  60
SDGNMEARSL IRGIDVNRAI TVIDCDEEVM VSSPNSTVSS LSGKRSEREE NEGELEDDAA  120
ARKKLRLSKE QAAVLEETFK EHSTLNPKQK MGLAKQLNLR PRQVEVWFQN RRARTKLKQT  180
EVDCEYLRRC CENLTEENRR LQKEVSELRA LKLSPQFYMN MSPPTTLTMC PQCERVAVSA  240
SSSSTTTXXX XXXXXXXXXX INSWPPAIHR PRT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089804.11e-134PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466021e-85HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A068UP951e-112A0A068UP95_COFCA; Uncharacterized protein
STRINGSolyc01g090460.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485